PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_008773
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family BES1
Protein Properties Length: 323aa    MW: 34744.7 Da    PI: 8.8186
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_008773genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822212.11.4e-65201601137
       DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpl....eeaeaagssasaspessl 94 
                  gg++rkp+w+ErEnnkrRERrRRaiaakiyaGLRaqGn++lpk++DnneVlkALc+ AGwvve DGttyrkgs+p+     +++++g+s++++p+ss 
  DCAR_008773  20 GGGRRKPSWRERENNKRRERRRRAIAAKIYAGLRAQGNFNLPKHCDNNEVLKALCARAGWVVESDGTTYRKGSRPPsldiGSMDIGGTSTHTTPCSSR 117
                  689************************************************************************9999899***************9 PP

       DUF822  95 qsslkssalaspvesysaspksssfpspssldsislasaasll 137
                    s+ ssa++sp++sy++sp+sssfpsps+ld  +++++ s++
  DCAR_008773 118 WPSPPSSAFQSPIPSYQPSPSSSSFPSPSRLDAQMSSNPFSFM 160
                  9*******************************99888763333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056871.5E-6221169IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MMNWEGESPA SSAAAGGSGG GGRRKPSWRE RENNKRRERR RRAIAAKIYA GLRAQGNFNL  60
PKHCDNNEVL KALCARAGWV VESDGTTYRK GSRPPSLDIG SMDIGGTSTH TTPCSSRWPS  120
PPSSAFQSPI PSYQPSPSSS SFPSPSRLDA QMSSNPFSFM RYSNPSSLPP LRISNSCPVT  180
PPLSSSTTGI SMQNFNWESI AKQSASLSFP FLAASAPSSP TRGQRVPPAT IPECDESDSS  240
TVDSERWMNF KTCAPPLVPT SPTFNLVKPA TQNISSQNAL SDKGKGIDFE FEKEPVKAWE  300
GERIHEVGLD DLELTLGSGG MQ*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12241RRKPSWRERENNKRRERRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009767052.11e-123PREDICTED: protein BRASSINAZOLE-RESISTANT 1-like
SwissprotQ8S3071e-103BZR1_ARATH; Protein BRASSINAZOLE-RESISTANT 1
TrEMBLA0A068UH771e-126A0A068UH77_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000398791e-116(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28122454
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75080.22e-79BES1 family protein